Protein coding transcript 2141

• Transcript: Ll_transcript_459008
• CDS coordinates: 172-846 (+)
• Peptide sequence: MRENDNPESSLLHPIPITIPEDKYHFAYSIYFMIGLGYLLPWNAFITAVDYFSYLYPDVSVDRIFALVYMLLSLIGIFLIILYTHKSDPFLRINLGFALFLLSLLIVPLLDAFHLHSHLAFYVTAASVALAGVADALVQASIVGSAGQLPERYMQAVIAGTAASGMDFPFHCSTFYVIFPISFWICLLLQGFLFLSSGYSQNLFTHRIPLACERVQISTFLSQL*
• ORF Type: complete

Annotations of Ll_transcript_459008

• Blastp: Equilibrative nucleotide transporter 1 from Arabidopsis with 55.29% of identity
• Blastx: Equilibrative nucleotide transporter 1 from Arabidopsis with 65.85% of identity
• Eggnog: solute carrier family 29 (nucleoside transporters), member(ENOG410Y3MT)
• Kegg: Link to kegg annotations (AT1G70330)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019450847.1)
• Pfam: Nucleoside transporter (PF01733.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;