Protein coding transcript 214140

• Transcript: Ll_transcript_217780
• CDS coordinates: 1723-2259 (+)
• Peptide sequence: MIYYGMTEPGKHLGVAGLGGLGHVAIKFGKAFGLKVTVISSSPNKESEAISKLGADSFLLSTDPAKFKEAIGTMDYIIDTISAVHSLTSLLALLKLNGKLVTVGLPSKPLELPVFPLVMGRKLIGGSNFGGIKETQEMLNFCGKHNIAADIELIKIDQINTAMERLVKSDVKYRFVIDV
• ORF Type: 3prime_partial

Annotations of Ll_transcript_217780

• Blastp: Probable mannitol dehydrogenase 1 from Stylosanthes with 88.27% of identity
• Blastx: Probable mannitol dehydrogenase 1 from Stylosanthes with 85.03% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019464294.1)
• Pfam: Zinc-binding dehydrogenase (PF00107.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;