Transcript | Ll_transcript_217746 |
---|---|
CDS coordinates | 1204-1740 (+) |
Peptide sequence | MIYYGMTEPGKHLGVAGLGGLGHVAIKFGKAFGLKVTVISSSPNKESEAISKLGADSFLLSTDPAKFKEAIGTMDYIIDTISAVHSLTSLLALLKLNGKLVTVGLPSKPLELPGFPLVMGRKLIGGSNFGGIKETQEMLNFCGKHNIAADIELIKIDQINTAMERLVKSDVKYRFVIDV |
ORF Type | 3prime_partial |
Blastp | Probable mannitol dehydrogenase 1 from Stylosanthes with 88.27% of identity |
---|---|
Blastx | Probable mannitol dehydrogenase 1 from Stylosanthes with 85.03% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019464294.1) |
Pfam | Zinc-binding dehydrogenase (PF00107.25) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer