Protein coding transcript 214146

• Transcript: Ll_transcript_217754
• CDS coordinates: 1201-1593 (+)
• Peptide sequence: MIYYGMTEPGKHLGVAGLGGLGHVAIKFGKAFGLKVTVISSSPNKESEAISKLGADSFLLSTDPAKFKEAIGTMDYIIDTISAVHSLTSLLALLKLNGKLVTVGLPSKPLELPVFPLVMGKPYNLLYDTM*
• ORF Type: complete

Annotations of Ll_transcript_217754

• Blastp: Probable cinnamyl alcohol dehydrogenase 9 from Arabidopsis with 77.69% of identity
• Blastx: Probable mannitol dehydrogenase 1 from Stylosanthes with 84.32% of identity
• Eggnog: alcohol dehydrogenase(COG1064)
• Kegg: Link to kegg annotations (AT4G39330)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019464294.1)
• Pfam: Zinc-binding dehydrogenase (PF00107.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;