Protein coding transcript 214152

• Transcript: Ll_transcript_218370
• CDS coordinates: 3-398 (+)
• Peptide sequence: PSQLVKRPRVSVGGEDLRTFYTLVLVDADAPSPSNPFLKEYLHWMVTDIPATTSAVFGKEVMFYEKPEPSAGIHRNVFILFKQLGRDTVITPEWRQNFKSRSFAETNNLVPVAAAYFNCQREHGCGGRRSE*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_218370

• Blastp: Protein FLOWERING LOCUS T from Arabidopsis with 69.23% of identity
• Blastx: Protein FLOWERING LOCUS T from Arabidopsis with 69.23% of identity
• Eggnog: phosphatidylethanolamine-binding protein(COG1881)
• Kegg: Link to kegg annotations (AT1G65480)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019420861.1)
• Pfam: Phosphatidylethanolamine-binding protein (PF01161.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;