Protein coding transcript 214211

• Transcript: Ll_transcript_219527
• CDS coordinates: 2175-2663 (+)
• Peptide sequence: MLELYEQNKIPPSQGSEIEGTAGGTKADVKAPAVNEEQASEQISSHSAAKHSSAEKVEVPLRGTENQINDGSAEMGSDITDHKVDLEIGDSHNSEPQQQPKKDNKGEVANRSKSVTEQTSAEDQDQNLEHREGLLNYSPKDAIKMIDKDKVKAALKKRRKERG
• ORF Type: 3prime_partial

Annotations of Ll_transcript_219527

• Blastp: Cyclin-T1-4 from Arabidopsis with 33.13% of identity
• Blastx: Cyclin-T1-3 from Oryza sativa with 55.83% of identity
• Eggnog: Component of the Mediator complex, a coactivator involved in regulated gene transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. Binds to and activates cyclin-dependent kinase cdk8 that phosphorylates the CTD (C-terminal domain) of the large subunit of RNA polymerase II (RNAp II), which may inhibit the formation of a transcription initiation complex(COG5333)
• Kegg: Link to kegg annotations (AT4G19600)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019419549.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;