Transcript | Ll_transcript_218467 |
---|---|
CDS coordinates | 331-1161 (+) |
Peptide sequence | MSCKGHSAVLLKDRILILKKGSKPDDQIWFLEFDTQYVRQLQKNLGTEVVAWSKGVTGNAEKPIVISGPSGVGKGTLISMLMKEFPTMFGFSVSHTTRSPRNMEKDGVHYHFTEKCLMEKEIEDGKFLEFASVHGNLYGTSVEAVEVVADAGKRCILDIDVQGARSVRASSLEAVFIFICPPSMEDLENRLRGRGTETEEQVLKRLRNAEAEIKEGKSYKIFDFILYNDNLEECYERLKKLLGLDGFVAAAPKSEPREIILPMDHSLSKKDDKIIIN |
ORF Type | 3prime_partial |
Blastp | Guanylate kinase 2 from Arabidopsis with 73.45% of identity |
---|---|
Blastx | Guanylate kinase 2 from Arabidopsis with 69.43% of identity |
Eggnog | Essential for recycling GMP and indirectly, cGMP (By similarity)(COG0194) |
Kegg | Link to kegg annotations (AT3G57550) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019444086.1) |
Pfam | Guanylate kinase (PF00625.20) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer