Protein coding transcript 214254

• Transcript: Ll_transcript_218480
• CDS coordinates: 36-1052 (+)
• Peptide sequence: MGEAPAFLVDDLQNEPPNGFELKNGTCKTTTTIGDKTYVIGGADDGTLSIEVQIFDRNLGEWFHPTVHGTKPMSCKGHSAVLLKDRILILKKGSKPDDQIWFLEFDTQYVRQLQKNLGTEVVAWSKGVTGNAEKPIVISGPSGVGKGTLISMLMKEFPTMFGFSVSHTTRSPRNMEKDGVHYHFTEKCLMEKEIEDGKFLEFASVHGNLYGTSVEAVEVVADAGKRCILDIDVQGARSVRASSLEAVFIFICPPSMEDLENRLRGRGTETEEQVLKRLRNAEAEIKEGKSYKIFDFILYNDNLEECYERLKKLLGLDGFVAAAPKSGKVFKEVDEFVL*
• ORF Type: complete

Annotations of Ll_transcript_218480

• Blastp: Guanylate kinase 2 from Arabidopsis with 68.88% of identity
• Blastx: Guanylate kinase 2 from Arabidopsis with 67.98% of identity
• Eggnog: Essential for recycling GMP and indirectly, cGMP (By similarity)(COG0194)
• Kegg: Link to kegg annotations (AT3G57550)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019444084.1)
• Pfam: Guanylate kinase (PF00625.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;