| Transcript | Ll_transcript_459071 |
|---|---|
| CDS coordinates | 368-697 (+) |
| Peptide sequence | MEQICEREVNLRAEVKEMENKLTKLRGGVTLVRPEERKAVEDILSEKISQWRKRKRMFKDLWDTLTENSPKDPKEFKEELGIEYDEDVGVSLQSYSDLLQPAKKRPRGQ* |
| ORF Type | complete |
| Blastp | Homologous-pairing protein 2 homolog from Arabidopsis with 71.56% of identity |
|---|---|
| Blastx | Homologous-pairing protein 2 homolog from Arabidopsis with 72.95% of identity |
| Eggnog | INteracting protein(ENOG410XT3U) |
| Kegg | Link to kegg annotations (AT1G13330) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019455387.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer