Protein coding transcript 214319

• Transcript: Ll_transcript_218752
• CDS coordinates: 196-528 (+)
• Peptide sequence: MVGHGQETIICAGSDVCLKKKELLSSAMKRTSEWISSQEIASDINVQIGEATFLLHKVEHKLLLGRNLRHFQGLKLEEEKIVIIMVRKICQRMMDHRQKGRRRGGLTWSK*
• ORF Type: complete

Annotations of Ll_transcript_218752

• Blastp: BTB/POZ domain-containing protein At5g67385 from Arabidopsis with 76.92% of identity
• Blastx: Homeobox-leucine zipper protein ATHB-13 from Arabidopsis with 94.29% of identity
• Eggnog: BTB POZ domain-containing protein(ENOG410XRIY)
• Kegg: Link to kegg annotations (AT5G67385)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019421013.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;