Protein coding transcript 214321

• Transcript: Ll_transcript_218735
• CDS coordinates: 1238-1546 (+)
• Peptide sequence: MGVALSITSFHVLARILAELKLLTTDVGRMAMSAAVVNDVAAWILLALAIALSGSETSPLIQLNAGIFCLIVQHNQYMSNNSVCVSLFGNATTSKFKDIFSL*
• ORF Type: complete

Annotations of Ll_transcript_218735

• Blastp: Cation/H(+) antiporter 18 from Arabidopsis with 85.71% of identity
• Blastx: Homeobox-leucine zipper protein ATHB-13 from Arabidopsis with 67.06% of identity
• Eggnog: Sodium hydrogen exchanger(COG0475)
• Kegg: Link to kegg annotations (AT5G41610)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_014492595.1)
• Pfam: Sodium/hydrogen exchanger family (PF00999.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;