Transcript | Ll_transcript_219879 |
---|---|
CDS coordinates | 3-395 (+) |
Peptide sequence | TLLFERDVIAMSFAPKDEHEAQVQFALERGIPAISAVMGTQRLQFPSSVFDLVHCARCRVPWHEEGGMLLLELNRVLRPGGYFAWSATPVYQKLEEDVEIWNEMSSLTKAMCWDLVTINKDKLNHVGAAIY |
ORF Type | internal |
Blastp | Probable methyltransferase PMT27 from Arabidopsis with 85.38% of identity |
---|---|
Blastx | Probable methyltransferase PMT27 from Arabidopsis with 85.38% of identity |
Eggnog | Methyltransferase(ENOG410Y2C5) |
Kegg | Link to kegg annotations (AT3G51070) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019421795.1) |
Pfam | Putative S-adenosyl-L-methionine-dependent methyltransferase (PF03141.15) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer