Protein coding transcript 214388

• Transcript: Ll_transcript_219819
• CDS coordinates: 2-382 (+)
• Peptide sequence: YECAVNIEDLVKLSDVMVEHSLGPNGGLVYCMDYLEKNIDWLQAKLEPLLKDHYLLFDFPGQVELFFSSFKCQECHNETHKEIEPTVTAVHSIDAHLCSDPGKYISALLLSLSTMLHHELPHIDVV*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_219819

• Blastp: GPN-loop GTPase 2 from Sus with 54.76% of identity
• Blastx: GPN-loop GTPase 2 from Sus with 53.47% of identity
• Eggnog: GPNloop GTPase 2(ENOG410YRVC)
• Kegg: Link to kegg annotations (100525877)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020210818.1)
• Pfam: Conserved hypothetical ATP binding protein (PF03029.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;