Transcript | Ll_transcript_219821 |
---|---|
CDS coordinates | 497-862 (+) |
Peptide sequence | MWKIGLDTTSLIIQNTVLSLFIIYSLIFLDKWNSFFLHSNAKNVIMKLIKKLNLQVLFCYLHLRCQPGCYLNNLFVCSFFAVTAVHSIDAHLCSDPGKYISALLLSLSTMLHHELPHIDVV* |
ORF Type | complete |
Blastp | GPN-loop GTPase 2 from Danio with 61.9% of identity |
---|---|
Blastx | GPN-loop GTPase 2 from Danio with 55.56% of identity |
Eggnog | GPNloop GTPase 2(ENOG410YRVC) |
Kegg | Link to kegg annotations (407722) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_003628594.2) |
Pfam | Conserved hypothetical ATP binding protein (PF03029.16) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer