Protein coding transcript 214453

• Transcript: Ll_transcript_202862
• CDS coordinates: 1183-1848 (+)
• Peptide sequence: MQDPTLFQPMKPQFPEQEQLKCPRCDSTNTKFCYYNNYNLSQPRHFCKNCRRYWTKGGSLRNIPVGGGTRKNTKRPSTNSKRAASSSSQSPSPSVSSVSITPQVPAAATEIEPNRNDPAQAYSISGSFSSLLASADNLGSLLEGLNSSGSNMKMVQMNECGSSGPMMNLDPGRNNIGSGVQGSGNAAENFMNMQNGDSSCWNGSSNGWSNLAIYTPGSTFQ*
• ORF Type: complete

Annotations of Ll_transcript_202862

• Blastp: Dof zinc finger protein DOF1.7 from Arabidopsis with 56.64% of identity
• Blastx: Dof zinc finger protein DOF1.7 from Arabidopsis with 82.67% of identity
• Eggnog: Zinc finger protein(ENOG410YJE1)
• Kegg: Link to kegg annotations (AT1G51700)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019436481.1)
• Pfam: Dof domain, zinc finger (PF02701.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;