Transcript | Ll_transcript_202863 |
---|---|
CDS coordinates | 1015-1680 (+) |
Peptide sequence | MQDPTLFQPMKPQFPEQEQLKCPRCDSTNTKFCYYNNYNLSQPRHFCKNCRRYWTKGGSLRNIPVGGGTRKNTKRPSTNSKRAASSSSQSPSPSVSSVSITPQVPAAATEIEPNRNDPAQAYSISGSFSSLLASADNLGSLLEGLNSSGSNMKMVQMNECGSSGPMMNLDPGRNNIGSGVQGSGNAAENFMNMQNGDSSCWNGSSNGWSNLAIYTPGSTFQ* |
ORF Type | complete |
Blastp | Dof zinc finger protein DOF1.7 from Arabidopsis with 56.64% of identity |
---|---|
Blastx | Dof zinc finger protein DOF1.7 from Arabidopsis with 82.67% of identity |
Eggnog | Zinc finger protein(ENOG410YJE1) |
Kegg | Link to kegg annotations (AT1G51700) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019436481.1) |
Pfam | Dof domain, zinc finger (PF02701.14) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer