Protein coding transcript 214475

• Transcript: Ll_transcript_200780
• CDS coordinates: 366-845 (-)
• Peptide sequence: AKPVNSRPHDHHIPLQPTAKPVNSRPHDHHIPLQPTAKPVNSRPYRYPHSQKDLMTKMLTEMLQAGIVVPSNSPFSSPVLLVRKKDGSWRFCVDYRALNAITIPDRFPIPTIDELLDELGAHQYFLKLICVQDTIRFGFIRPIHTRRLFGLSMVIMSSW*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_200780

• Blastp: Transposon Ty3-I Gag-Pol polyprotein from Saccharomyces with 42.98% of identity
• Blastx: Retrovirus-related Pol polyprotein from transposon 17.6 from Sophophora with 55.88% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (YIL082W-A)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020997135.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;