Transcript | Ll_transcript_202105 |
---|---|
CDS coordinates | 2555-3106 (+) |
Peptide sequence | MHALCIFVVDEPSGSSNADSLALMEFYMKRAAQEERSRRPKYSKDEMPPPASLQAASGKKGHHMGDYIPLEELEKFMATCNDAEAQKAAKEAAERAKIQADNVGHKLLSKMGWKEGEGLGSSRKGIADPIMAGSVKKDNLGVGAVQPGEVTPEDDIYEQYKKRMMLGYRHRPNPLNNPRKAYY* |
ORF Type | complete |
Blastp | SURP and G-patch domain-containing protein 1-like protein from Arabidopsis with 77.9% of identity |
---|---|
Blastx | SURP and G-patch domain-containing protein 1-like protein from Arabidopsis with 77.9% of identity |
Eggnog | RNA splicing(ENOG410ZSH4) |
Kegg | Link to kegg annotations (AT3G52120) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019453415.1) |
Pfam | G-patch domain (PF12656.6) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer