Protein coding transcript 214522

• Transcript: Ll_transcript_200609
• CDS coordinates: 387-1217 (+)
• Peptide sequence: MSVQSTLKLQTSSSSFEGNPLHKTMKKPQRKVVRIIVTDNDATDSESSSDEEQKKKQKRVKREITQITMNFPLFDSPSSSSCSRSCSCSSFSSSSEQCCKKYNRPKKSLSSTASAAVRHSNKFRGVRQRPWGRWAAEIRDPSRRKRVWLGTFDTAEEAATVYDKAAVKLKGSNAITNFPAPANENEVMTQATAGEIQSVDGGSSYSNAVASPTSVLHYHSGSTLFDGFSYGDVDAFGFDIDMALSLPDVNVMLTCQRFGKEEVFGEFDLDEFMSWP*
• ORF Type: complete

Annotations of Ll_transcript_200609

• Blastp: Pathogenesis-related genes transcriptional activator PTI6 from Lycopersicon with 45.08% of identity
• Blastx: Pathogenesis-related genes transcriptional activator PTI6 from Lycopersicon with 52.98% of identity
• Eggnog: Pathogenesis-related genes transcriptional activator(ENOG410YQGI)
• Kegg: Link to kegg annotations (544043)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019461675.1)
• Pfam: AP2 domain (PF00847.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;