Transcript | Ll_transcript_200579 |
---|---|
CDS coordinates | 429-1166 (+) |
Peptide sequence | MQCLRFENHSLILTCKQFSHLFGALFWLVTITFCITFALIISATVGKAACAPALVICNAIFTDIMLHAGDTNYYDIRKKCEGSLCYDFSNMEKFLNQKSVRDSLGVGKIHFVSCSTEVHTALLLDWMRNLEVGIPALLEDGINLLVYAGEYDLICNWLGNSRWVHAMEWSGQKQFGASPEVPFVVNGSEAGLLKNYGPLSFLKVHDAGHMVPMDQPKAALEMLKKWTTGTLSESRADGENLVADM* |
ORF Type | complete |
Blastp | Serine carboxypeptidase-like from Pisum with 80.38% of identity |
---|---|
Blastx | Serine carboxypeptidase-like from Pisum with 68.44% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019449818.1) |
Pfam | Serine carboxypeptidase (PF00450.21) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer