Protein coding transcript 214616

• Transcript: Ll_transcript_200567
• CDS coordinates: 2-442 (+)
• Peptide sequence: YSSQVGDQSKHYKFITNITNCSRKTKNMVSLSLPSILKMCVSFLMLFSLIFVSTSMSAPSYSTNNGLHFSSPASVPKLQAENLIRGLNLFPKHTINTPLSDPHFVPGKIVEKKFSFLNFDDSLGPSVQEFGHHAGYYPLPQSKAAR*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_200567

• Blastp: Serine carboxypeptidase-like 48 from Arabidopsis with 44.25% of identity
• Blastx: Serine carboxypeptidase-like 48 from Arabidopsis with 44.25% of identity
• Eggnog: carboxy-peptidase(COG2939)
• Kegg: Link to kegg annotations (AT3G45010)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019447818.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;