Protein coding transcript 214635

• Transcript: Ll_transcript_200751
• CDS coordinates: 235-618 (+)
• Peptide sequence: MVYFFCQPEYLQSGRATEKSDVYSFGVLLLELITGKRPTDPSFVKRGLNVVGWMNTLVKENRLEEVVDKRCKDVDAGSLEVILEVAARCTDANADDRPTMNQVLQILEQEVMSPCPSEFYESHSDHS*
• ORF Type: complete

Annotations of Ll_transcript_200751

• Blastp: LRR receptor-like serine/threonine-protein kinase FEI 2 from Arabidopsis with 55.65% of identity
• Blastx: LRR receptor-like serine/threonine-protein kinase FEI 2 from Arabidopsis with 45.54% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT2G35620)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019451119.1)
• Pfam: Protein tyrosine kinase (PF07714.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;