Protein coding transcript 214670

• Transcript: Ll_transcript_202610
• CDS coordinates: 1-783 (+)
• Peptide sequence: SMTLRYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYSFTTTAEREIVRDVKEKLAYIALDYEQELETSKTSSAVEKSYELPDGQVITIGAERFRCPEVLFQPSMIGMEAVGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEISALAPSS
• ORF Type: internal

Annotations of Ll_transcript_202610

• Blastp: Actin-97 from Solanum with 96.92% of identity
• Blastx: Actin-97 from Solanum with 96.92% of identity
• Eggnog: Actin-related protein(COG5277)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019414134.1)
• Pfam: Actin (PF00022.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;