| Transcript | Ll_transcript_202613 |
|---|---|
| CDS coordinates | 3-581 (+) |
| Peptide sequence | TCYNELRGAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYSFTTTAEREIVRDVKEKLAYIALDYEQELETSKTSSAVEKSYELPDGQVITIGAERFRCPEVLFQPSMIGMEAVGIHETTYNS |
| ORF Type | internal |
| Blastp | Actin-97 from Solanum with 96.89% of identity |
|---|---|
| Blastx | Actin-97 from Solanum with 96.89% of identity |
| Eggnog | Actin-related protein(COG5277) |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019414134.1) |
| Pfam | Actin (PF00022.18) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer