Protein coding transcript 214676

• Transcript: Ll_transcript_202597
• CDS coordinates: 88-666 (+)
• Peptide sequence: MYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYSFTTTAEREIVRDVKEKLAYIALDYEQELETSKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQPSMIGMEAVGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSS
• ORF Type: 3prime_partial

Annotations of Ll_transcript_202597

• Blastp: Actin from Gossypium with 98.45% of identity
• Blastx: Actin from Gossypium with 98.2% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (107932458)
• CantataDB: -
• Mirbase: gga-mir-3533 (MI0015386)
• Ncbi protein: Link to NCBI protein (XP_019447946.1)
• Pfam: Actin (PF00022.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;