Transcript | Ll_transcript_202599 |
---|---|
CDS coordinates | 2-490 (+) |
Peptide sequence | ELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYSFTTTAEREIVRDVKEKLAYIALDYEQELETSKTSSAVEKSYELPDGQVITIGAERF |
ORF Type | internal |
Blastp | Actin from Gossypium with 98.16% of identity |
---|---|
Blastx | Actin from Gossypium with 98.16% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (107932458) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019458660.1) |
Pfam | Actin (PF00022.18) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer