Protein coding transcript 214681

• Transcript: Ll_transcript_202604
• CDS coordinates: 2-901 (+)
• Peptide sequence: DAPRAVFPSIVGRPRHTGVMVGMGQKDAYVGDEAQSKRGILTLKYPIEHGIVSNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDALMKILTERGYSFTTTAEREIVRDVKEKLAYIALDYEQELETSKTSSSVEKSYELPDGQVITIGAERFRCPEVLFQPSMIGMEAVGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSS
• ORF Type: internal

Annotations of Ll_transcript_202604

• Blastp: Actin-66 from Solanum with 98% of identity
• Blastx: Actin-66 from Solanum with 98% of identity
• Eggnog: Actin-related protein(COG5277)
• Kegg: -
• CantataDB: -
• Mirbase: gga-mir-3533 (MI0015386)
• Ncbi protein: Link to NCBI protein (XP_004487013.1)
• Pfam: Actin (PF00022.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;