Protein coding transcript 21471

• Transcript: Ll_transcript_319462
• CDS coordinates: 628-1086 (+)
• Peptide sequence: MTCRSYYKCTHPGCPVRKHVERASHDLRAVITTYEGKHNHDVPAARGSGNHSVNRPMPTNNTSNPNNAAIRPMPLNHSTNNSLQSLRPQAQDQGQSPFSLEMLQSPGSFGFSGLGNPMGSYMNQQQQLSDNVFSSRAKEEPRDDTFLDSLLC*
• ORF Type: complete

Annotations of Ll_transcript_319462

• Blastp: Probable WRKY transcription factor 33 from Arabidopsis with 50.33% of identity
• Blastx: Probable WRKY transcription factor 33 from Arabidopsis with 47.06% of identity
• Eggnog: WRKY transcription factor(ENOG4112BTF)
• Kegg: Link to kegg annotations (AT2G38470)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019432183.1)
• Pfam: WRKY DNA -binding domain (PF03106.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;