Protein coding transcript 214712

• Transcript: Ll_transcript_201521
• CDS coordinates: 245-718 (-)
• Peptide sequence: MGSHTPKNILIAGAAGFIASHVANKLVRSDPDYKMVVLGKLDYCSNLKNLIPSKPSPNFKFVKSDIGSADYLLITESIDTIMHCAAQTQVDNSFGNSFEFTKNIIYGTPVLLEARKVTGQIRKFSQVSTDEVYGETDEDNNSSRVVSKFCSTPNICL*
• ORF Type: complete

Annotations of Ll_transcript_201521

• Blastp: Trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 3,5-epimerase/UDP-4-keto-L-rhamnose-reductase RHM1 from Arabidopsis with 82.39% of identity
• Blastx: Trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 3,5-epimerase/UDP-4-keto-L-rhamnose-reductase RHM1 from Arabidopsis with 82.39% of identity
• Eggnog: dTDP-glucose 4-6-dehydratase(COG1088)
• Kegg: Link to kegg annotations (AT1G78570)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_006585326.1)
• Pfam: NAD dependent epimerase/dehydratase family (PF01370.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;