Protein coding transcript 214746

• Transcript: Ll_transcript_200935
• CDS coordinates: 196-732 (+)
• Peptide sequence: MVVNAMLVAMVTHANHPSDTIYHVTSSVRKPLRYGDIQDYGYTYFTEKPWIDKDGKPVKVGKCVILKNMDSFRRYMFIRYVLLLKGLEFANTAFCQYFKGTYLDLNRKIQIVMRLMELYKPFLFFKGVFDDMNTEKLRMAARQGGVEADLFYFDPEVINWDDYFLNTHLPGAAKYIFK*
• ORF Type: complete

Annotations of Ll_transcript_200935

• Blastp: Alcohol-forming fatty acyl-CoA reductase from Simmondsia with 50.84% of identity
• Blastx: Alcohol-forming fatty acyl-CoA reductase from Simmondsia with 51.91% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (AAD38039)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019413807.1)
• Pfam: Male sterility protein (PF03015.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;