Protein coding transcript 214786

• Transcript: Ll_transcript_201363
• CDS coordinates: 652-996 (+)
• Peptide sequence: MSQFRRKFKCYHCGEEGHIKRNCKDWKNRDNKYQRNTTKDENTTTPVIDGEVVLLSSGDEECHVADSCEEWIVDSAASYHATPNKELFTMYKAGDFDKVRMGNSSNANIVGVGDV
• ORF Type: 3prime_partial

Annotations of Ll_transcript_201363

• Blastp: Retrovirus-related Pol polyprotein from transposon TNT 1-94 from Nicotiana with 42.2% of identity
• Blastx: Retrovirus-related Pol polyprotein from transposon TNT 1-94 from Nicotiana with 32.89% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: ppe-MIR6276 (MI0021642)
• Ncbi protein: Link to NCBI protein (XP_016168674.1)
• Pfam: Zinc knuckle (PF00098.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;