Transcript | Ll_transcript_459083 |
---|---|
CDS coordinates | 1-414 (+) |
Peptide sequence | IFQTLTQSERKLKQYQMTSIFKLFFLTHFFIMVFKAKGECNLKDISISQMETGNWAHGMPELSVNITNNCACIHKNVKINCTDFHSYKGIDPLILSVPIDETCLLKNGNDFFAFETLNFLYAWEPQFPFTPIYSQVVW |
ORF Type | internal |
Blastp | Protein TAPETUM DETERMINANT 1 from Arabidopsis with 35.48% of identity |
---|---|
Blastx | Protein TAPETUM DETERMINANT 1 from Arabidopsis with 35.48% of identity |
Eggnog | NA(ENOG410YPRQ) |
Kegg | Link to kegg annotations (AT4G24972) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_004492178.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer