Protein coding transcript 2148

• Transcript: Ll_transcript_459083
• CDS coordinates: 1-414 (+)
• Peptide sequence: IFQTLTQSERKLKQYQMTSIFKLFFLTHFFIMVFKAKGECNLKDISISQMETGNWAHGMPELSVNITNNCACIHKNVKINCTDFHSYKGIDPLILSVPIDETCLLKNGNDFFAFETLNFLYAWEPQFPFTPIYSQVVW
• ORF Type: internal

Annotations of Ll_transcript_459083

• Blastp: Protein TAPETUM DETERMINANT 1 from Arabidopsis with 35.48% of identity
• Blastx: Protein TAPETUM DETERMINANT 1 from Arabidopsis with 35.48% of identity
• Eggnog: NA(ENOG410YPRQ)
• Kegg: Link to kegg annotations (AT4G24972)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_004492178.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;