Protein coding transcript 214845

• Transcript: Ll_transcript_202413
• CDS coordinates: 1-339 (+)
• Peptide sequence: SDASGTMGGACGYGNLYSQGYGTNTAALSTALFNNGLSCGSCYEIKCVSDHKWCLAGSILVTATNFCPPNNALPNNAGGWCNPPQHHFDLAQPVFLRIAQYRAGIVPVAYRR*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_202413

• Blastp: Expansin-A1 from Arabidopsis with 90.09% of identity
• Blastx: Expansin-A1 from Arabidopsis with 90.09% of identity
• Eggnog: loosening and extension of plant cell walls by disrupting non-covalent bonding between cellulose microfibrils and matrix glucans. No enzymatic activity has been found(ENOG410YCRV)
• Kegg: Link to kegg annotations (AT1G69530)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019456511.1)
• Pfam: Lytic transglycolase (PF03330.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;