| Transcript | Ll_transcript_459091 |
|---|---|
| CDS coordinates | 177-554 (+) |
| Peptide sequence | MVKDTKFYEQLGCSPDATEAQLKTAYRKGALKHHPDKNNHSPESEEKFKEISHAYEVLSDPQQRQIYDQYGEEGLEQGGGMGGGGMGAEDLFAQFFGGGGGPFGGMFGGGMGGGREQGPKKARTIP |
| ORF Type | 3prime_partial |
| Blastp | Mitochondrial protein import protein MAS5 from Saccharomyces with 58.1% of identity |
|---|---|
| Blastx | Protein psi1 from Schizosaccharomyces with 67.14% of identity |
| Eggnog | - |
| Kegg | Link to kegg annotations (YNL064C) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_016190681.1) |
| Pfam | DnaJ domain (PF00226.30) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer