Protein coding transcript 2150

• Transcript: Ll_transcript_459002
• CDS coordinates: 1-450 (+)
• Peptide sequence: ATSILHRQQLMFKYVALIRENWDRLAASITLEQGKTIADAKGDVLRGLQVAETACGITTQITGEVLEVAKDMETRSYREPLGVVAAICPFNFPAMIPLWTIPIATITGNTCIIKPSERDPGATMILAELAEKAGFPPGVINIVHGAAKTV
• ORF Type: internal

Annotations of Ll_transcript_459002

• Blastp: Probable methylmalonate-semialdehyde dehydrogenase [acylating], mitochondrial from Stegomyia with 64% of identity
• Blastx: Probable methylmalonate-semialdehyde dehydrogenase [acylating], mitochondrial from Stegomyia with 64% of identity
• Eggnog: Dehydrogenase(ENOG410XNP1)
• Kegg: Link to kegg annotations (AaeL_AAEL001134)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_013462423.1)
• Pfam: Aldehyde dehydrogenase family (PF00171.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;