Protein coding transcript 21508

• Transcript: Ll_transcript_319578
• CDS coordinates: 435-785 (+)
• Peptide sequence: MGPLFLELGIAPQVASATATFGMTFSASISVVQYYLLNRFPVPYALYLTLVAAIAAYIGQHIINKLVNLFGRASLIIFVLAFTIFVSTIALGGVGISDMIGKIERNEYMGFEDLCN*
• ORF Type: complete

Annotations of Ll_transcript_319578

• Blastp: Sulfite exporter TauE/SafE family protein 3 from Arabidopsis with 71.55% of identity
• Blastx: Sulfite exporter TauE/SafE family protein 3 from Arabidopsis with 61.11% of identity
• Eggnog: cereblon(ENOG410XQGE)
• Kegg: Link to kegg annotations (AT2G25737)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019458948.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;