Protein coding transcript 215082

• Transcript: Ll_transcript_202250
• CDS coordinates: 2-781 (+)
• Peptide sequence: KRVKVEDEEDEEEEEEYEVQDDDDDGDDVAADDYDEGEASDGDAFDAPASDGAFKWQRVEKLCNEVREFGANIIDADELASVYDFRIDKFQRLAIQAFLRGSSVVVSAPTSSGKTLIAEAAAVATVARGRRIFYTTPLKALSNQKFREFRETFGDTNVGLLTGDSAINKEAQVLIMTTEILRNMLYQSVGNASSGGGLFHVDAIVLDEVHYLSDISRGTVWEEIVIYCPKEVQLICLSATVANPDELAGWIGQVLRLCW*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_202250

• Blastp: DExH-box ATP-dependent RNA helicase DExH15 chloroplastic from Arabidopsis with 88.56% of identity
• Blastx: DExH-box ATP-dependent RNA helicase DExH15 chloroplastic from Arabidopsis with 88.56% of identity
• Eggnog: helicase(COG4581)
• Kegg: Link to kegg annotations (AT1G70070)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019445516.1)
• Pfam: DEAD/DEAH box helicase (PF00270.28)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;