Protein coding transcript 215171

• Transcript: Ll_transcript_202849
• CDS coordinates: 881-1186 (+)
• Peptide sequence: MTFPSTCGACATKCETRMFVTNIPYFQEVIVMASTCDACGYRNSELKPGGRIPEKGKRITLHVKNVNDLSRDIIKELLSFGRDQEKCCSCGLFRRGSGSTVA
• ORF Type: 3prime_partial

Annotations of Ll_transcript_202849

• Blastp: Zinc finger protein zpr1 from Schizosaccharomyces with 54.05% of identity
• Blastx: Zinc finger protein ZPR1 from Mus with 33% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (SPAC15A10.04c)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019420287.1)
• Pfam: ZPR1 zinc-finger domain (PF03367.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;