Protein coding transcript 215176

• Transcript: Ll_transcript_202837
• CDS coordinates: 649-1395 (+)
• Peptide sequence: MDEAGVSGQVRRVPHGSIGAAAGHRAIAQSNSAEIADALFRYTAPEEVMTFPSTCGACVTQCETRMFVTNIPYFQEVIVMASTCDSCGYRNSELKPGGRIPEKGKTITLHVENVKDLSRDVIKSDTASVKVPEIDLELTSGTLGGVVTTVEGLITKICESLEKVHGFTFGDSLQEDRKNKWLDFTARLTKLLSLEEPWTLILDDALANSFVAPATDDLAADKQLTCKFFSPRFSEYKLYLMQLAFSKF*
• ORF Type: complete

Annotations of Ll_transcript_202837

• Blastp: Zinc finger protein ZPR1 homolog from Dictyostelium with 48.09% of identity
• Blastx: Zinc finger protein ZPR1 homolog from Dictyostelium with 39.94% of identity
• Eggnog: zinc ion binding(COG1779)
• Kegg: Link to kegg annotations (DDB_G0269438)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019424241.1)
• Pfam: ZPR1 zinc-finger domain (PF03367.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;