Transcript | Ll_transcript_458997 |
---|---|
CDS coordinates | 1-633 (+) |
Peptide sequence | VKWPRYIRVQRQKNVLQKRLKVPPAINQFTQTLDKQTAIQLFKLLDKYRPETAEAKKARLIARAEKKAATKEDTPTKRPNTVRAGVNTVVTLVEQKKAQLVCIAHDVEPIELVVFLPALCRKMGVPYCIVKGKARLGRVVNRKTCTALCLTQVESGDRAQLAKLVESVKTNFNDRSEEIRKHWGGGVLGSKSAARIAKLEKAKAKELAQKQ |
ORF Type | internal |
Blastp | 60S ribosomal protein L7a from Bos with 76.67% of identity |
---|---|
Blastx | 60S ribosomal protein L7a from Takifugu with 74.49% of identity |
Eggnog | (ribosomal) protein(COG1358) |
Kegg | Link to kegg annotations (513128) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_013456527.1) |
Pfam | Ribosomal protein L7Ae/L30e/S12e/Gadd45 family (PF01248.25) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer