Protein coding transcript 215221

• Transcript: Ll_transcript_200212
• CDS coordinates: 2-781 (+)
• Peptide sequence: FPLHLFVQVAVENRERKRKHQKMATNIGIMDSAYFVGRSEILSWINSTLQLNLSKVEEACSGAVHCQLMDAAHPGTVPMHKVNFDAKNEYDMIQNYKVLQDVFNKLKITKYIEVNKLVKGRPLDNLEFMQWMKRYCDSVNSGAYNYNPLERREVCKGGREVGKKSAQSHSSTKGSSAPKSHSSHTARRNDVSSTNNTNQAAKAVRPSSVSNPAYDKQITELKLSIDNLEKERDFYFGKLRDIEILCQTPEIEHLTVLHS*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_200212

• Blastp: Microtubule-associated protein RP/EB family member 1C from Arabidopsis with 67.33% of identity
• Blastx: Microtubule-associated protein RP/EB family member 1C from Arabidopsis with 67.33% of identity
• Eggnog: microtubule-associated protein RP EB family member(COG5217)
• Kegg: Link to kegg annotations (AT5G67270)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446799.1)
• Pfam: Calponin homology (CH) domain (PF00307.30)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;