Protein coding transcript 215229

• Transcript: Ll_transcript_201184
• CDS coordinates: 1-369 (+)
• Peptide sequence: PLSPPSLSSPPPSRATTSSSSSEGKSKISRTAIIVVVLVIVVVVVLLIICIPLYLRRRNERKFLIAEEDDNSDGITTRQSLQFNFDTIRVATSGFSSSNKLGQGGFGAVYMVRYHHHFISIK*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_201184

• Blastp: Cysteine-rich receptor-like protein kinase 25 from Arabidopsis with 46.67% of identity
• Blastx: Cysteine-rich receptor-like protein kinase 10 from Arabidopsis with 65.17% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT4G05200)
• CantataDB: Link to cantataDB annotations (CNT0002983)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019452496.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;