Protein coding transcript 215250

• Transcript: Ll_transcript_200447
• CDS coordinates: 2044-2853 (+)
• Peptide sequence: MPRGSLENHLFRKGPLPLPWSIRMKIALGAAKGLAFLHEEAKRPIIYRDFKTSNILLDAEYNAKLSDFGLAKDGPEGEKTHVSTRVMGTYGYAAPEYVMTGHLTSKSDVYSFGVVLLEMLTGRRSIDKRRPNGEHNLVEWARPVLGNWRMFLRMIDPRLEGHFSVKGAQKAAQLAAQCLSRDPKVRPVMSEVVQTLKPLPNLKDMAISSYHFQVARVDRTLSMPNRKSVIKTQLVSLPKKGQPIRTLSSPNAPHGSPYPHYSKSPKPNG*
• ORF Type: complete

Annotations of Ll_transcript_200447

• Blastp: Probable serine/threonine-protein kinase PIX7 from Arabidopsis with 74.17% of identity
• Blastx: Probable serine/threonine-protein kinase PIX7 from Arabidopsis with 78.3% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT5G15080)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019427825.1)
• Pfam: Protein tyrosine kinase (PF07714.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;