Protein coding transcript 215251

• Transcript: Ll_transcript_200448
• CDS coordinates: 519-1064 (+)
• Peptide sequence: MFLAGKKSSFEESANETIAPPESSSTTSNAESIPSTPKFSEELKVASSLRKFTFNGLRVATRNFRPESLLGEGGFGCVFKGWIEENGTAPMKPGTGLTVAVKTLNHNGKQGHKEWLAELNYLGDLLHPNLVKLIGFCIEDDQRLLVYEFMPRGSLDNHLFRSTLLTPFIPECLYLCLFISV*
• ORF Type: complete

Annotations of Ll_transcript_200448

• Blastp: Probable serine/threonine-protein kinase PIX7 from Arabidopsis with 74.69% of identity
• Blastx: Probable serine/threonine-protein kinase PIX7 from Arabidopsis with 74.69% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (AT5G15080)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019427827.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;