Protein coding transcript 215334

• Transcript: Ll_transcript_200158
• CDS coordinates: 240-1217 (+)
• Peptide sequence: MQSSGKSSVLESIVGRDFLPRGSGIVTRRPLVLQLYKTEEGTQEHAEFLHLPKKRFTDFSLVRKEIEDETDRVTGKSNKISPVPIHLSIYSPHVVNLTLIDLPGLTKVAVEGQPDSIVQEIEGMVLSYIEKPNCIILAITPANQDVATSDAIKVARQVDPSGERTFGVLTKLDLMDKGTNALDVIEGRSYRLRNPWVGIVNRSQADINRKVDMISARQREHKFFATSPDYAQIANRMGAEYLAKLLSKHLESAIRARIPGIASLINRTIDDLEAEMAHLGRPVAIDAGVRSIYCQYQLNVIPVLKFIKLLLILSGTTLHHSRIVP*
• ORF Type: complete

Annotations of Ll_transcript_200158

• Blastp: Dynamin-related protein 1E from Arabidopsis with 77.16% of identity
• Blastx: Dynamin-related protein 1E from Arabidopsis with 76.27% of identity
• Eggnog: Dynamin family(COG0699)
• Kegg: Link to kegg annotations (AT3G60190)
• CantataDB: Link to cantataDB annotations (CNT0000439)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019430483.1)
• Pfam: Dynamin family (PF00350.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;