Protein coding transcript 21534

• Transcript: Ll_transcript_319608
• CDS coordinates: 2-340 (+)
• Peptide sequence: CREEYSNWARLVLWVLAELALIAADIQEVIGSAIALKILSNGLLPIWVGVIITASDCFFFLFLENYGVRKLEGVFAVFIGTMAFSFAWMFFDTKPSEEELLMGTTLSNDMVF*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_319608

• Blastp: Metal transporter Nramp4 from Arabidopsis with 74.76% of identity
• Blastx: Metal transporter Nramp2 from Arabidopsis with 79.36% of identity
• Eggnog: H( )-stimulated, divalent metal cation uptake system (By similarity)(COG1914)
• Kegg: Link to kegg annotations (AT5G67330)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019429264.1)
• Pfam: Natural resistance-associated macrophage protein (PF01566.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;