Protein coding transcript 215351

• Transcript: Ll_transcript_201281
• CDS coordinates: 409-1224 (+)
• Peptide sequence: MAYPHYRSQFGDTTFTKVFVGGLAWETPTEELRKYFEQFGDILEAVIITDKNTGKSKGYGFVTFRDPESARRACSDPNPVIDGRRANCNIASLGRPRSSPPRGSGAFQGGGTGTVHGAGSNSGVPAAGPPALTPPLLYPQPYGYPSYIPEYGYHQATLYNTQIQQAQYYQQLYGQSSNTMASPYYYGYSVQAPRGTFSTPQAHRLPAGASYAYYPTSPMEGSSAFRLPYQPATRQIPSSSSDSENQKRTSSETASEAVVITSENSNPQGKS*
• ORF Type: complete

Annotations of Ll_transcript_201281

• Blastp: RNA-binding protein 38 from Gallus with 52.17% of identity
• Blastx: RNA-binding protein 38 from Gallus with 68.29% of identity
• Eggnog: NA(ENOG410YDBV)
• Kegg: Link to kegg annotations (768866)
• CantataDB: Link to cantataDB annotations (CNT0001828)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019430930.1)
• Pfam: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) (PF00076.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;