Protein coding transcript 215359

• Transcript: Ll_transcript_201290
• CDS coordinates: 278-1021 (+)
• Peptide sequence: MAYQHYRSQFGDTTFTKVFVGGLAWETPTEEMRKYFEQFGDILEAVIITDKNTGKSKGYGFVTFRDHESARRACADSNPVIDGRRANCNIASLGRPRPSPPRGRGTFQGGGGTGTVQGAGTYSGVPSAGPAALSPPPLLYPQPYGYPTYTPDYGYHQATMYNPQIQQAQYYQQFYGPSTSTIGSPYYYGYSVQAPRGTFSTPQAHRLPAGPSYIYYPTSPIEGSSAFRAPYQPATRQIPPSTSGNLI*
• ORF Type: complete

Annotations of Ll_transcript_201290

• Blastp: Probable RNA-binding protein ARP1 from Arabidopsis with 68.48% of identity
• Blastx: Probable RNA-binding protein ARP1 from Arabidopsis with 69.05% of identity
• Eggnog: RNA binding motif protein(ENOG4111PGT)
• Kegg: Link to kegg annotations (AT3G54770)
• CantataDB: Link to cantataDB annotations (CNT0001828)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019460938.1)
• Pfam: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) (PF00076.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;