Protein coding transcript 215371

• Transcript: Ll_transcript_200452
• CDS coordinates: 1562-2173 (+)
• Peptide sequence: MGKGEAWVNGQSIGRYWPTYISSNAGCTDSCNYRGHYSSSKCHKNCGKPSQTLYHVPRSWLKPNGNILVLFEERGGDPTQISFATKDIQSLCAHVSETHPPPLDLWNSDTESGTKVGPVLSLKCSDHKQLISSIKFASYGTPLGTCGNFNHGHCSSNKAMSIVQKVLYLASSLNFKFIVTSIFWIKFYGISVNYRVYNNSSKI*
• ORF Type: complete

Annotations of Ll_transcript_200452

• Blastp: Beta-galactosidase 8 from Arabidopsis with 64.32% of identity
• Blastx: Beta-galactosidase 8 from Arabidopsis with 65.33% of identity
• Eggnog: beta-galactosidase(COG1874)
• Kegg: Link to kegg annotations (AT2G28470)
• CantataDB: Link to cantataDB annotations (CNT0001217)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019458428.1)
• Pfam: Galactose binding lectin domain (PF02140.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;