Protein coding transcript 215374

• Transcript: Ll_transcript_200456
• CDS coordinates: 289-930 (+)
• Peptide sequence: MGKGEAWVNGKSIGRYWPAYFSSNSGCTGSCNYRGAYSSSKCLKNCGKPSQSLYHVPRSWLKRSGNILVLFEEKGGDPTQISFATKQIGSLCAHVSQSHPPSIDLWNSDTKSVSEAAPALSLKCPEHNQVISSIKFASYGTPLGTCGNFYHGNCSSNNAMSIVQKVLSSLLFKFQLYNVFSLVTLDLIFIQSQYQGISSLHGTRRSCPKFIEC*
• ORF Type: complete

Annotations of Ll_transcript_200456

• Blastp: Beta-galactosidase 8 from Arabidopsis with 69.05% of identity
• Blastx: Beta-galactosidase 8 from Arabidopsis with 68.72% of identity
• Eggnog: beta-galactosidase(COG1874)
• Kegg: Link to kegg annotations (AT2G28470)
• CantataDB: Link to cantataDB annotations (CNT0001217)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019447890.1)
• Pfam: Galactose binding lectin domain (PF02140.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;